PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00840.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 239aa    MW: 26457.1 Da    PI: 8.299
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00840.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1895149256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++tkeq  +Le+ F+++++++ +++  LA++l+L  rqV vWFqNrRa++k
  Zpz_sc00840.1.g00010.1.sm.mk  95 RKKLRLTKEQSAVLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARRK 149
                                   78889************************************************98 PP

2HD-ZIP_I/II117.66.9e-3895183190
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq+++LE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR k+kq E+d+e Lkr y++l+een+rL+
  Zpz_sc00840.1.g00010.1.sm.mk  95 RKKLRLTKEQSAVLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARRKLKQAEVDCELLKRFYETLTEENRRLH 175
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLree 90 
                                    e ++Lr +
  Zpz_sc00840.1.g00010.1.sm.mk 176 CELQRLR-A 183
                                   ******9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-1981152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-1885145IPR009057Homeodomain-like
PROSITE profilePS5007117.00691151IPR001356Homeobox domain
SMARTSM003895.6E-1693155IPR001356Homeobox domain
CDDcd000869.39E-1795152No hitNo description
PfamPF000463.9E-1695149IPR001356Homeobox domain
PROSITE patternPS000270126149IPR017970Homeobox, conserved site
PfamPF021839.1E-8151184IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.0E-15151194IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEHEEVGLAL GLSLGSGHHW FKEQPPPPPS QLCALEPSMS ISIRADDGSL PTQARPLNGA  60
VKREFPVEDD GGPMDRGLYS VVSSAADDDE GCNSRKKLRL TKEQSAVLED RFKEHSTLNP  120
KQKVALANQL NLRPRQVEVW FQNRRARRKL KQAEVDCELL KRFYETLTEE NRRLHCELQR  180
LRALNHPHPA AFFMPGAALS ICPSCERLAS TPGAATATDR PKATGPAPLL SNFTKSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19399SRKKLRL
2143151RRARRKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983488.11e-109PREDICTED: homeobox-leucine zipper protein HOX15-like
SwissprotQ7G7377e-73HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLK4AE821e-109K4AE82_SETIT; Uncharacterized protein
STRINGSi037189m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-61HD-ZIP family protein